PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017650m
Common NameCARUB_v10017650mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 323aa    MW: 36142.4 Da    PI: 8.0387
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017650mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +++ +v+ +G g+W++I+++ g++R++k+c++rw +yl
  Carubv10017650m 14 KGLWTEEEDAKILAYVAIHGVGNWSLIPKKAGLNRCGKSCRLRWTNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding53.26.7e-1769110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++++E+el++++++  G++ W+tIar+++ gRt++++k++w++
  Carubv10017650m  69 SFSPQEEELIIQCHRIIGSR-WSTIARKLP-GRTDNDVKNHWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129427.917965IPR017930Myb domain
SuperFamilySSF466899.54E-3111108IPR009057Homeodomain-like
SMARTSM007172.3E-161363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001671.40E-131761No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129419.5766116IPR017930Myb domain
SMARTSM007177.7E-1566114IPR001005SANT/Myb domain
CDDcd001673.09E-1169110No hitNo description
PfamPF002492.7E-1469110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRPPCCDKS NVKKGLWTEE EDAKILAYVA IHGVGNWSLI PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDSF SPQEEELIIQ CHRIIGSRWS TIARKLPGRT DNDVKNHWNT KLKKKLMKMG  120
IDPVTHKPVS QVLSEFRNIS GHGNASFKTE PSNNSVLTQT NSAWEMMRNT TMSHETYFNN  180
SPMIFTNPGS SEIQTTPFHF SNHSNHLLNG TTSSCSSSSS SASITQPNQG TQAPVTNFCW  240
DDFLLSDPVL PQSSQKQVVG SSATSNLTFA QNEHHFNRQA ECSSQKIVSD PSRSASSFVD  300
EILDKDQEML SQFPQLLNDF DY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545800.0AC254580.1 Capsella rubella clone JGIBSIA-5G22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291503.10.0hypothetical protein CARUB_v10017650mg
SwissprotQ9LSI70.0MYB35_ARATH; Transcription factor MYB35
TrEMBLR0FQI40.0R0FQI4_9BRAS; Uncharacterized protein
STRINGBra025337.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.10.0MYB family protein